SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 380935 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  380935
Domain Number 1 Region: 21-173
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.66e-37
Family RecA protein-like (ATPase-domain) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 380935
Sequence length 178
Comment $ JCSG $ SQ136983 $ PDBT36537 $
Sequence
MVAQLETPSANSSLSLPYPIEGLVQVFTSSHRNFFTSVMGQALRIAGQGTPVLIVQFLKG
GIKQGQDRPIQLGQNLDWIRCDLPRCIDTPHLDESENQALQKLWLHTQQVVDEDKYSLVV
LDELSLAIHFGLIPESDVLAFLAKRSPHVDIIFTGTEMPQSILDVADQITEIRRSHCP
Download sequence
Identical sequences A0A1W5CQP2 Q3M9Q4
gi|75908881|ref|YP_323177.1| 380935 240292.Ava_2669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]