SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 388711 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  388711
Domain Number 1 Region: 3-212
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.68e-48
Family ABC transporter ATPase domain-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 388711
Sequence length 214
Comment $ JCSG $ SQ148241 $ PDBT39850 $
Sequence
MAHIEVEKLCKTINKSIVLEDINLDMSSGKVYGFQGINGSGKTMLMRALIGLIRPTSGKV
CIDGKELGKDIDFPESIGFLLENPAFLDMYSGEDNLKLLAKVDGNVDKKSVENEIRGLID
DVGLGQAGRKKYKKYSLGMKQRLGIAAAVLGNPDIVVLDEPTNALDDDGKEMVKSVVRKQ
KERGALVIISCHDMQTLEELSDEIVKLKEGRICG
Download sequence
Identical sequences A0A1Q6PFY3 C4ZDF3 R6TMY5
515619.EUBREC_3202 WP_012743956.1.32465 388711 gi|238925546|ref|YP_002939063.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]