SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 390051 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  390051
Domain Number - Region: 34-119
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00714
Family Anticodon-binding domain 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 390051
Sequence length 132
Comment $ JCSG $ SQ148840 $ PDBT40732 $
Sequence
ASKAFYSAGDKLFQPGDDAVASMQTYSVAQFLQPFTLNPAKASSDYLGKWVKVRGVIVDI
RRKSGIAGSYYFIVTMRDEQNKTDKRLTFNFGSHNSADVEALSNGSVATIVGQVHQVQDS
TIPTLQNPKVVK
Download sequence
Identical sequences 390051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]