SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 391772 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391772
Domain Number 1 Region: 76-200
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.92e-44
Family NlpC/P60 0.0013
Further Details:      
 
Domain Number 2 Region: 35-75
Classification Level Classification E-value
Superfamily SH3-domain 0.0000127
Family SH3-domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 391772
Sequence length 201
Comment $ JCSG $ SQ153732 $ PDBT41995 $
Sequence
AAEPTNSPMSATVDQCDFLNVRSGASANDAVVGKINTGDKVEVLELHSNGWIKIKSVDNV
TGWVNGDYLTIQGGNVDAKVQNVLNLAFKQQGKPYKWGATGPNSFDCSGFTSYVYKNGAG
VNLPRVSRSQATVGKKVSRAELKPGDLVFFGSGGSINHVGLYVGDSKFIHSPQTGDVVKV
TSMAPGTNYARRLITATRVLQ
Download sequence
Identical sequences 391772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]