SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 418981 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  418981
Domain Number - Region: 112-189
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0036
Family Papain-like 0.04
Further Details:      
 
Domain Number - Region: 26-153
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0471
Family Papain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 418981
Sequence length 225
Comment $ JCSG $ SQ236581 $ PDBT52114 $
Sequence
KDIDIPFLNSLKKVVSDSDTDSAANSKKELKGSAKPLDVILYNQMDAPRLYNGCEVTSLA
MVLNYAGYDVTKNTLANQVATVPLTYSSGLKGDPNDGFVGDMANGPGLGVYHRPIYQLAK
TYAGDKVSDLTGKSISAVYQQLEKGNPVWVITTANFTPVDNMQTWKTPNGTIEITYSEHS
VAVTGYDDKYVYLNDPYGYKNRKTDRTSFEKAWKQMGSQAVVIQK
Download sequence
Identical sequences 418981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]