SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AF1681_1_212 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AF1681_1_212
Domain Number - Region: 17-121
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0439
Family BAR domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AF1681_1_212
Sequence length 197
Comment $ OCSP $ SQ130911 $ PDBT354074 $
Sequence
MKKFMINCFVHLKEICYLSDMDILENMVKNLLKYESEVHKLLSTYESAGKSRIIRLDESY
KELDGLSIEQDELFREALRCVENGLFRAAHVLAWAGFIDFLHSILALHIPQIKNKKEKWK
ISKKEDFREYPDFQIIEAAKDVGILNKSEMKTLKGLLSKRNECAHPSDYFPDLNETLGYI
SELLKRIKILQMRIKEK
Download sequence
Identical sequences A0A075WE58 O28593
gi|11499270|ref|NP_070508.1| 224325.AF1680 377922 AF1681_1_212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]