SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for APC1682 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC1682
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.04e-48
Family YuzD-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC1682
Sequence length 108
Comment $ MCSG $ SQ15248 $ PDBT55523 $
Sequence
MMKPVMLSVYGAENVCASCVNMPTAKDTYEWLEAALKRKYPNQPFEMQYIDIHEPPDNEH
AKELAEKIRNDEYFYPLVLVEDKIVGEGNPKLKDVYEEMEKHGYTENR
Download sequence
Identical sequences A0A125UM45 A0A164TMK9 A0A1B2BEI9 O32118
gi|560130216|ref|YP_008831357.1| gi|470163434|ref|YP_007535209.1| gi|16080274|ref|NP_391101.1| 224308.BSU32210 NP_391101.1.22788 WP_003242597.1.101301 WP_003242597.1.11257 WP_003242597.1.1140 WP_003242597.1.11581 WP_003242597.1.12759 WP_003242597.1.15902 WP_003242597.1.16291 WP_003242597.1.19261 WP_003242597.1.25531 WP_003242597.1.27372 WP_003242597.1.27660 WP_003242597.1.2914 WP_003242597.1.32219 WP_003242597.1.32420 WP_003242597.1.33846 WP_003242597.1.36189 WP_003242597.1.39605 WP_003242597.1.40859 WP_003242597.1.44140 WP_003242597.1.44184 WP_003242597.1.45019 WP_003242597.1.47157 WP_003242597.1.52860 WP_003242597.1.56274 WP_003242597.1.56411 WP_003242597.1.57201 WP_003242597.1.5726 WP_003242597.1.57513 WP_003242597.1.6139 WP_003242597.1.6517 WP_003242597.1.65223 WP_003242597.1.7186 WP_003242597.1.72152 WP_003242597.1.72999 WP_003242597.1.76977 WP_003242597.1.78686 WP_003242597.1.81116 WP_003242597.1.81747 WP_003242597.1.82722 WP_003242597.1.88042 WP_003242597.1.91723 WP_003242597.1.93420 WP_003242597.1.94199 WP_003242597.1.96043 WP_003242597.1.979 gi|402777378|ref|YP_006631322.1| APC1682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]