SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for APC22432 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  APC22432
Domain Number - Region: 38-89
Classification Level Classification E-value
Superfamily Histone-fold 0.00984
Family Nucleosome core histones 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC22432
Sequence length 111
Comment $ MCSG $ SQ16367 $ PDBT61611 $
Sequence
MSEELLSQEEIEFLMETLEKKKVEKIPQGLQPFDFDSLEKISSERYPRLEQFLSTFTERL
SEELKKITLSNLKVKVKEKDVKPLSKILPNLSPPVVFIRQHLEEVGDFTHC
Download sequence
Identical sequences O67284
NP_213848.1.100253 224324.aq_1239 gi|15606468|ref|NP_213848.1| APC22432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]