SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for APC27888 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC27888
Domain Number 1 Region: 65-231
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.25e-37
Family Retroviral integrase, catalytic domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) APC27888
Sequence length 237
Comment $ MCSG $ SQ21596 $ PDBT67327 $
Sequence
MAHIRTRETYGTRRLQTELAENGIIVGRDRLARLRKELRLRCKQKRKFRATTNPNHNLPV
APNLLNQTFAPTAPNQVWVADLTYVATQEGWLYLAGIKDVYTCEIVGYAMGERMTKELTG
KALFMALRSQRPPAGLIHHSDRGSQYCAYDYRVIQEQFGLKTSMSRKGNCYDNAPMESFW
GTLKNESLSHYRFNNRDEAISVIREYIEIFYNRQRRHSRLGNISPAAFREKHHQMAA
Download sequence
Identical sequences A0A0H2VYM5
gi|30063961|ref|NP_838132.1| 198215.S2794 APC27888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]