SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for APC336 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC336
Domain Number 1 Region: 4-197
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.28e-97
Family Nucleotide and nucleoside kinases 0.00000054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) APC336
Sequence length 206
Comment $ MCSG $ SQ14332 $ PDBT54422 $
Sequence
MTYIVGLTGGIGSGKTTIANLFTDLGVPLVDADVVAREVVAKDSPLLSKIVEHFGAQILT
EQGELNRAALRERVFNHDEDKLWLNNLLHPAIRERMKQKLAEQTAPYTLFVVPLLIENKL
TALCDRILVVDVSPQTQLARSAQRDNNNFEQIQRIMNSQVSQQERLKWADDVINNDAELA
QNLPHLQQKVLELHQFYLQQAENKNA
Download sequence
Identical sequences P44920
1jjv_A NP_439051.1.63031 WP_010869082.1.61635 WP_010869082.1.9694 gi|16273638|ref|NP_439051.1| 71421.HI0890m 1jjvA APC336 cath|current|1jjvA00/1-205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]