SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for APC38766 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  APC38766
Domain Number - Region: 181-206
Classification Level Classification E-value
Superfamily PMT central region-like 0.0667
Family PMT central region-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC38766
Sequence length 214
Comment $ MCSG $ SQ204554 $ PDBT74993 $
Sequence
MKIAIFSKLTIKEDQIRKKMDGLDVDIYPPIKRGDLTSKKIFDYDIIGIIDGCFLQNTAV
AHREILKVIQNNTTVFGAGSMGALRASELDTCGMIGVGSVYSLYKHGIITDDDEVAVTFD
DNLNQITFSMISFREMINNALKDKIIDEDDSKRLINSGKKLYYPLRTFENVIEKSGISGE
KKEILEKYLKNQPDIKRNDALEMLEEIIKYVEKQ
Download sequence
Identical sequences A4FX66
APC38766 gi|134045524|ref|YP_001097010.1| 402880.MmarC5_0481 WP_011868250.1.72418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]