SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for APC39193.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC39193.1
Domain Number 1 Region: 139-277
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.000000000000196
Family Histidine kinase 0.033
Further Details:      
 
Weak hits

Sequence:  APC39193.1
Domain Number - Region: 79-155
Classification Level Classification E-value
Superfamily PMT central region-like 0.0114
Family PMT central region-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC39193.1
Sequence length 278
Comment $ MCSG $ SQ213456 $ PDBT75969 $
Sequence
TLGAHLCLGPLYAWGGLESYLFVVRAVFAPSIAAEIGAQYQWILFANLTVYIIQFALYHL
VRNVQRLRQKERQATEFLAMAREQQLAALKAQVNPHFLFNTLNSISATLRQDPERAREMI
AKLSDMMRYALEGPDREFVPLREEIAFTRRYLDLERHRFSDRLRARMDVDADTDALDTPV
PPMVLQPLVENALRHGIAPSEDGGSVTVAVTAEHDTLDVHVEDTGVGPDADDPLSGSTDG
TGLATTSTRLERTYGPDAALHTARNDPTGFKVWFSIPR
Download sequence
Identical sequences APC39193.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]