SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for APC40597 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  APC40597
Domain Number - Region: 136-173
Classification Level Classification E-value
Superfamily Histone-fold 0.0858
Family TBP-associated factors, TAFs 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) APC40597
Sequence length 243
Comment $ MCSG $ SQ211722 $ PDBT77191 $
Sequence
MHLTREVNIMSILSAVSRVINNFSTEIKNRVVEVGSNLKKSTEEFIGEVVIKAAVNRLKQ
GMLNALSSSNDTTKDNGNDLSTNSPDIEDVSAPTLSSKKKTEANTTLVGSTGIMQKLLGN
IGVNSEQSIEVLSKHFNGAVERFTQDVSKAANEAVCEKIKSIQPEDVVKGINSLIGNTLK
VDSESGDTTLSFKLESAVQILGVILAAMGMLMFASQTKSTEQKTLEIEHLPTEEIQPPSL
AIH
Download sequence
Identical sequences A0A2J9NLK1 G8UT73 Q5ZX35
WP_010946633.1.100609 WP_010946633.1.100881 WP_010946633.1.101326 WP_010946633.1.101385 WP_010946633.1.11666 WP_010946633.1.1173 WP_010946633.1.1188 WP_010946633.1.12035 WP_010946633.1.12661 WP_010946633.1.13050 WP_010946633.1.14235 WP_010946633.1.15016 WP_010946633.1.15769 WP_010946633.1.16078 WP_010946633.1.16593 WP_010946633.1.16748 WP_010946633.1.16962 WP_010946633.1.17809 WP_010946633.1.17857 WP_010946633.1.19321 WP_010946633.1.19554 WP_010946633.1.20369 WP_010946633.1.2062 WP_010946633.1.2085 WP_010946633.1.21466 WP_010946633.1.21493 WP_010946633.1.21849 WP_010946633.1.22734 WP_010946633.1.23459 WP_010946633.1.24053 WP_010946633.1.24333 WP_010946633.1.2441 WP_010946633.1.24636 WP_010946633.1.26718 WP_010946633.1.27674 WP_010946633.1.28040 WP_010946633.1.28814 WP_010946633.1.29717 WP_010946633.1.29802 WP_010946633.1.30351 WP_010946633.1.30583 WP_010946633.1.30653 WP_010946633.1.30822 WP_010946633.1.3122 WP_010946633.1.31291 WP_010946633.1.3258 WP_010946633.1.32659 WP_010946633.1.33708 WP_010946633.1.35082 WP_010946633.1.35118 WP_010946633.1.35787 WP_010946633.1.35807 WP_010946633.1.36016 WP_010946633.1.36420 WP_010946633.1.37108 WP_010946633.1.37161 WP_010946633.1.37274 WP_010946633.1.37932 WP_010946633.1.38133 WP_010946633.1.3819 WP_010946633.1.41185 WP_010946633.1.41378 WP_010946633.1.41396 WP_010946633.1.41414 WP_010946633.1.41486 WP_010946633.1.43838 WP_010946633.1.44619 WP_010946633.1.44866 WP_010946633.1.44947 WP_010946633.1.45024 WP_010946633.1.45039 WP_010946633.1.46042 WP_010946633.1.46096 WP_010946633.1.46948 WP_010946633.1.47823 WP_010946633.1.47956 WP_010946633.1.48346 WP_010946633.1.48466 WP_010946633.1.49562 WP_010946633.1.50306 WP_010946633.1.50379 WP_010946633.1.51153 WP_010946633.1.51428 WP_010946633.1.51956 WP_010946633.1.52706 WP_010946633.1.52905 WP_010946633.1.53250 WP_010946633.1.53443 WP_010946633.1.53669 WP_010946633.1.53795 WP_010946633.1.53844 WP_010946633.1.54355 WP_010946633.1.547 WP_010946633.1.5553 WP_010946633.1.57055 WP_010946633.1.58065 WP_010946633.1.58425 WP_010946633.1.58541 WP_010946633.1.58606 WP_010946633.1.5861 WP_010946633.1.58655 WP_010946633.1.59183 WP_010946633.1.59227 WP_010946633.1.59576 WP_010946633.1.60239 WP_010946633.1.60770 WP_010946633.1.61482 WP_010946633.1.61895 WP_010946633.1.6243 WP_010946633.1.63249 WP_010946633.1.63282 WP_010946633.1.63357 WP_010946633.1.636 WP_010946633.1.64335 WP_010946633.1.64388 WP_010946633.1.64512 WP_010946633.1.64714 WP_010946633.1.64856 WP_010946633.1.65356 WP_010946633.1.65604 WP_010946633.1.6601 WP_010946633.1.66209 WP_010946633.1.66299 WP_010946633.1.6641 WP_010946633.1.67348 WP_010946633.1.68412 WP_010946633.1.69880 WP_010946633.1.70346 WP_010946633.1.72557 WP_010946633.1.728 WP_010946633.1.73029 WP_010946633.1.73276 WP_010946633.1.73409 WP_010946633.1.73915 WP_010946633.1.74438 WP_010946633.1.75016 WP_010946633.1.75353 WP_010946633.1.75911 WP_010946633.1.75926 WP_010946633.1.76298 WP_010946633.1.76893 WP_010946633.1.77472 WP_010946633.1.77852 WP_010946633.1.77866 WP_010946633.1.79030 WP_010946633.1.79423 WP_010946633.1.79768 WP_010946633.1.80208 WP_010946633.1.80678 WP_010946633.1.80733 WP_010946633.1.80817 WP_010946633.1.81040 WP_010946633.1.82765 WP_010946633.1.82883 WP_010946633.1.83499 WP_010946633.1.8363 WP_010946633.1.83690 WP_010946633.1.84032 WP_010946633.1.84081 WP_010946633.1.85699 WP_010946633.1.86349 WP_010946633.1.87629 WP_010946633.1.87656 WP_010946633.1.89129 WP_010946633.1.89135 WP_010946633.1.89155 WP_010946633.1.89171 WP_010946633.1.90392 WP_010946633.1.90650 WP_010946633.1.90718 WP_010946633.1.91040 WP_010946633.1.91480 WP_010946633.1.93200 WP_010946633.1.94262 WP_010946633.1.94483 WP_010946633.1.95613 WP_010946633.1.95686 WP_010946633.1.96018 WP_010946633.1.96370 WP_010946633.1.97528 WP_010946633.1.97635 WP_010946633.1.97870 WP_010946633.1.97946 WP_010946633.1.98470 WP_010946633.1.98928 YP_094932.1.86292 gi|378776850|ref|YP_005185287.1| APC40597 gi|52841133|ref|YP_094932.1| 272624.lpg0898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]