SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for APC4821 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC4821
Domain Number 1 Region: 221-310
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000986
Family FIS-like 0.01
Further Details:      
 
Weak hits

Sequence:  APC4821
Domain Number - Region: 173-232
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000296
Family Extended AAA-ATPase domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC4821
Sequence length 311
Comment $ MCSG $ SQ11124 $ PDBT56870 $
Sequence
MISEISHDVIWDLYEGEDYRDKILAEKWDVVFGEKILEMEDTLFVQSLRELELALKYAAA
RKDLETIKARFNLLLYTPELQGAKIKEILFQVLKFYNSFSIFALVSEKGVHRHAYVDFVT
GGNYLSLIYHEDLPLNINSHTVFIDDVPPDFSPAGLGGRKIILGMDSTPKNNIPFVEIPP
LRERKMDIPYMLDGVIKSLQFQGKTVKIDDDLTKLLIEYHWPGNTQEFLEKVYEIITLEN
PVDQAMKIASGIDEIKGLNLKEFVDSLVEFVEKKVIKKALEENEGNRKKVCEVLNMNYKT
LSYKMKKYGLT
Download sequence
Identical sequences Q9X1R6
NP_229380.1.35502 WP_010865365.1.29620 WP_010865365.1.45724 WP_010865365.1.51363 WP_010865365.1.56403 WP_010865365.1.79805 gi|15644328|ref|NP_229380.1| 283437 APC4821 243274.TM1580 gi|15644328|ref|NP_229380.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]