SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for APC61798.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC61798.1
Domain Number 1 Region: 12-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000979
Family Thioltransferase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) APC61798.1
Sequence length 129
Comment $ MCSG $ SQ162661 $ PDBT83543 $
Sequence
MTTKYWVTPTEDNLRWESLDERTIDDYVKQGKTVFVNVSADWCITCKTNKIGVILQNPVY
PALQQENVITMQGDWTHPSHKITEYLKKHQRYGVPLTVVYGPNTPQGLTLPVLLDGDEVI
HALNYAKGS
Download sequence
Identical sequences APC61798.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]