SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for APC62189.6 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  APC62189.6
Domain Number - Region: 6-21,88-132
Classification Level Classification E-value
Superfamily Porins 0.00256
Family Ligand-gated protein channel 0.081
Further Details:      
 
Domain Number - Region: 74-90
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0392
Family Type I dockerin domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) APC62189.6
Sequence length 277
Comment $ MCSG $ SQ199970 $ PDBT84406 $
Sequence
NKDMEFTLRANFTYSTNKVNYYEEGDTKYEYTSATGRPNGYMKGYIALGLFKDQEEINNS
PKQDFGSYLPGDIKYKDVNGDGVVNSDDQVPVSYQDYPRLMYGFGGEFRWKKLTLGVRFS
GIGNTDYYKIWTWGSNNVGYIPFYDGKLGNVLTIAANPANRWIPADYDDPSIPASMRENP
NAMFPRLSYGSNQNNAQASTFWKGNRKYLRLDEISLNYNCNCNLLKSIGINSIDLAVVAN
DLHTWDSVKLFDPELATSNGRAYPIPGRVSFQAIVHF
Download sequence
Identical sequences APC62189.6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]