SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for APC62690 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC62690
Domain Number 1 Region: 7-148
Classification Level Classification E-value
Superfamily HSP20-like chaperones 1.88e-20
Family HSP20 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) APC62690
Sequence length 156
Comment $ MCSG $ SQ174475 $ PDBT85684 $
Sequence
MRNSTDYSPLYRSFIGFDHLASLIDKASQPGKQSSYPPYNIELLAENQYRITMAVAGFRE
EDIDIESKDNGLIIVGTKQPPANSTQESEATTRHFLHQGIAERNFERKFQLGEHVKVIGA
FMENGLLHVDLEREIPEALKSRKIAINGKSLLNGNS
Download sequence
Identical sequences Q47Y72
167879.CPS_3580 APC62690 gi|71279649|ref|YP_270248.1| WP_011044334.1.15195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]