SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for APC63850.7 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC63850.7
Domain Number 1 Region: 33-182
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.6e-21
Family Pyruvate oxidase and decarboxylase PP module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) APC63850.7
Sequence length 209
Comment $ MCSG $ SQ195942 $ PDBT88591 $
Sequence
NRVSWLEKWQCLEKKGRKEIKCYLEQATDESAFVGELIKKTSEKDALFISNSMPIRDVDN
LLLNKNIDVYANRGANGIDGIVSTALGMAVHKRITLLIGDLSFYHDMNGLLMSKLNNIQM
NIVLLNNDGGGIFSYLPQKESATDYFERLFGTPTGLDFEYTAKLYQFDFKRFNSVSEFKN
ATLLSETSTIYELITNREDNFKQHQILYQ
Download sequence
Identical sequences APC63850.7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]