SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for APC68125.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC68125.1
Domain Number 1 Region: 2-169
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.33e-18
Family Protein kinases, catalytic subunit 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC68125.1
Sequence length 170
Comment $ MCSG $ SQ233075 $ PDBT97663 $
Sequence
SRLHGENLAGAWDRVPRDHRERLVTEVGETLAVLHSLDPGPLGDVLGPGDWGAFLDRQRA
GAVRRQRAHGLPAGWLEQIPDFLASVPLPRDPDGCLLHTEVMRQHLMVDPDGWRLTGLFD
FEPAMIGDRAYDFVGVGLFVTGGDPDLLARLAKAYGRSFDPSVLLAYTLL
Download sequence
Identical sequences APC68125.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]