SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for APC83673 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  APC83673
Domain Number - Region: 30-62
Classification Level Classification E-value
Superfamily Kringle-like 0.0628
Family Kringle modules 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC83673
Sequence length 76
Comment $ MCSG $ SQ27494 $ PDBT101294 $
Sequence
MQGCDHYIFLFRSVYDFTVNCYSMCLAFQLPIFEYWRRHFHQCRNADQNSHKPYWFLWQQ
HLSVCSSDHKSNMIGW
Download sequence
Identical sequences E3D287 Q9JY41
122586.NMB1757 gi|385329017|ref|YP_005883320.1| APC83673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]