SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for APC87368.2 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC87368.2
Domain Number 1 Region: 1-181
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.57e-56
Family Pyruvate oxidase and decarboxylase Pyr module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) APC87368.2
Sequence length 189
Comment $ MCSG $ SQ182043 $ PDBT108124 $
Sequence
MQKQLLLGVEAIAQAALDAGISGVYAYPGTPSTEITEHIQNSRMAKERNVHREWAANEKT
AMESALGMSYAGKRALVCMKHVGMNVAADCFMNAAITGANGGMVIVAADDPSMHSSQNEQ
DSRVYGQFAMIPVMEPSNQQEAYDMTRLAFDLSERLGTPVMMRITTRLAHSRAGVVQTEP
IGENELHLP
Download sequence
Identical sequences APC87368.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]