SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for APC90642.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  APC90642.1
Domain Number - Region: 50-134
Classification Level Classification E-value
Superfamily TPR-like 0.000211
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC90642.1
Sequence length 177
Comment $ MCSG $ SQ97054 $ PDBT113841 $
Sequence
QGQPLANFEGGQPMEALQQWTAAVVKAVEGKLPGITGDDAEAEPAEDPRFEPATEALNAG
DFDAAIAVYEEILRHEPKNQMALQARDNARLLSRLKDADRSVDPIAVADADLQDVDKAFA
AADAEITTGKVEEAFDRLIELLPNEKVRTRLLELYSVFEPSDSRVQAARSKMASKLF
Download sequence
Identical sequences APC90642.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]