SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AR23 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AR23
Domain Number 1 Region: 1-164
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.67e-22
Family Glutathione peroxidase-like 0.00000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AR23
Sequence length 164
Comment $ NESG $ SQ29993 $ PDBT117601 $
Sequence
MAPITVGDVVPDGTISFFDENDQLQTVSVHSIAAADGFLDFDLRIGVFGFSEVSMSHVPG
FIGKAEELKSKGIDEIICFSVNDPFVMKAWGKTYQENKHVKFVADGSGEYTHLLGLELDL
KDKGLGIRSRRFALLLDNLKVTVANVENGGEFTVSSAEDILKAL
Download sequence
Identical sequences AR23

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]