SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AR232 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AR232
Domain Number 1 Region: 29-92
Classification Level Classification E-value
Superfamily Histone-fold 0.00000628
Family Nucleosome core histones 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AR232
Sequence length 277
Comment $ NESG $ SQ1699 $ PDBT121910 $
Sequence
MKRRRRNSKLKFEETSDQSPTSTAEFSFSLTKIAVSQICQSIGYKATDASALNTLTLTTT
KFLQSLAELASSFSNTANRTEVNLFDIVNGLQDIALSTSDCFPGGSTVHDIESQCLIKSA
VLRNLSDFVTYAPEIPFAKPLPRRERDGSFGGDLDHVAVTRSVDVTSVPAWLPPFPDSSL
CSDRCSKDNRSDHLWENSDSVIRREILPESLKSKSGGRLPVMRDKVRFKMEQRDWSSGGD
TRLERSRDNNNGESGRDLEVKKKIREGYTYCAGEWPF
Download sequence
Identical sequences Q9SA19
3702.AT1G31240.1-P AT1G31240.1 AT1G31240.1 AR232 GO.4984 NP_174409.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]