SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AR3326 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AR3326
Domain Number 1 Region: 2-110
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000283
Family Single strand DNA-binding domain, SSB 0.054
Further Details:      
 
Domain Number 2 Region: 116-230
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000406
Family Single strand DNA-binding domain, SSB 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AR3326
Sequence length 235
Comment $ NESG $ SQ126998 $ PDBT143004 $
Sequence
MEGFHMVSELCSLITGWRIYVFVVRVFKKVISPNVFELGLILADYANNRIEATVDRRLAP
FYEDRFVENEWKTITSFLVRKSTDSVRATKHEYGILFMYRTVVVQAPPRSPPVPDFDFDP
FDYILEKSAYKNVLVDVVGALVDVGALTTDYYGLKLSFEIKDRYNKVLECEARNQQAEYL
DGYFQSLGKGNFVVALSFWRLTELSNPKLESHGAISKVVANPDRPEVADISMVVF
Download sequence
Identical sequences Q9M182
AR3326 3702.AT3G43370.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]