SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AR3339A from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AR3339A
Domain Number 1 Region: 4-109
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.42e-17
Family Single strand DNA-binding domain, SSB 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AR3339A
Sequence length 110
Comment $ NESG $ SQ150018 $ PDBT133794 $
Sequence
MAERNYIPDLNLHTNNHVLHVKILSIWDLQSMNKPTLCTMILCDVKGNRIDARIPWGEYM
NNFKTTLFEGKWYYLQHFRLKRATTIPKYTDFHYEIEFMWHTKMWHVSDR
Download sequence
Identical sequences AR3339A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]