SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AR3355B from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AR3355B
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000206
Family Single strand DNA-binding domain, SSB 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AR3355B
Sequence length 77
Comment $ NESG $ SQ150046 $ PDBT133377 $
Sequence
SPAAFVNGALLRRYIGQKVRAVIQVIRSDVGSVIGKSTDDQQIVVKGSPQPPLTTYLEVI
GIAETDNTIRAEVWTNF
Download sequence
Identical sequences AR3355B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]