SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AR3365D from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AR3365D
Domain Number 1 Region: 16-96
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000776
Family Cold shock DNA-binding domain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AR3365D
Sequence length 117
Comment $ NESG $ SQ150070 $ PDBT146485 $
Sequence
KILTFPVSFTCRTFLPARGDILQGTVKKVLWNGAFIRSGPLRYAYLSLLKMPHYHYVHSP
LSEDEKPHFQKDDLSKIAVGVVVRFQVLAVRFKERPHKRRNDYYVLATLEGNGSFGP
Download sequence
Identical sequences AR3365D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]