SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AR3366A from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AR3366A
Domain Number 1 Region: 4-108
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.11e-17
Family Single strand DNA-binding domain, SSB 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AR3366A
Sequence length 109
Comment $ NESG $ SQ150073 $ PDBT146488 $
Sequence
MDAEYHSIFELFPMITGWSIRAFVVRVFKKCVGINEFDLGLILADNRGMRSRIEATINRR
IASFYSDCIRENEWIIINTFSVRLHDEGIHTTSHDYRICFMDQTIVTKV
Download sequence
Identical sequences AR3366A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]