SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for BcR191B from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BcR191B
Domain Number 1 Region: 5-102
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.25e-20
Family Cold shock DNA-binding domain-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) BcR191B
Sequence length 103
Comment $ NESG $ SQ150133 $ PDBT146493 $
Sequence
MVEKMNEEVMDSKELQVGDVVTGSVTKVEEKQVLVNVGYKTDGVIPISELANVHIEKASD
VVELDQTLELKIIKLEEDDLVLSKRAVDAEKAWVELQEKFTSG
Download sequence
Identical sequences BcR191B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]