SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for BvR57C from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BvR57C
Domain Number 1 Region: 15-139
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000198
Family Galactose-binding domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) BvR57C
Sequence length 140
Comment $ NESG $ SQ182263 $ PDBT154489 $
Sequence
DRTDWDVSFSYAYGYDEAQFGGRLAVDGDVSTTWFTWGVVSAGECWWATTLPAPTHLTGF
SLTRQTTFGSSYNVREAKVKVKKEGDTEWTEAGLFRFGSFKGNDPQYAVFIPAVENVKEF
RIDIVSPADFTGFAELDLYQ
Download sequence
Identical sequences BvR57C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]