SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C07G1.2 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C07G1.2
Domain Number 1 Region: 203-309
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000266
Family Kringle modules 0.0036
Further Details:      
 
Domain Number 2 Region: 94-216
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000000158
Family C-type lectin domain 0.0064
Further Details:      
 
Domain Number 3 Region: 312-350
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000628
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 4 Region: 555-596
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000127
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 5 Region: 590-632
Classification Level Classification E-value
Superfamily SRCR-like 0.00000275
Family Scavenger receptor cysteine-rich (SRCR) domain 0.031
Further Details:      
 
Domain Number 6 Region: 348-414
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00000432
Family Hairpin loop containing domain 0.038
Further Details:      
 
Weak hits

Sequence:  C07G1.2
Domain Number - Region: 449-490
Classification Level Classification E-value
Superfamily SRCR-like 0.00157
Family Scavenger receptor cysteine-rich (SRCR) domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C07G1.2
Sequence length 635
Comment $ SECSG $ SQ46400 $ PDBT5079 $
Sequence
MRTILFFGIFFIFIFQCAKCIELKIFEDLLEVRSQSGLFFPLCSKSFHQKYGEQACASIS
STFLSYSTVSLQQYTYSVGCTTSVCFTFLSSFCKTGVKVFCSPSLCASGTLQIGSKCLSI
STVPVQGYSEANYYCNPATLISSLKPTEIESIRDTILPTFADTRLFLTSGLRQGATWKWG
NGDTVEQEVTGTGRCLALQAGNLVAIDCDSEAYVFCESGRECIARDKEYSGTANRTSDGK
MCLMWNDPTVLFRRERDLEILNHNFCRFVNDADGKKSATPVCYTKPNELSQCYIPPCPES
FNDVVPIESGDSCPIGSISCDNGSKCISEKFQCDYEVDCNDGSDEHNCEDYLQYYELIGA
YRLADNIIEVWTFIPHVQGCARKCRESLLMCEAFSYEPKSQTCLLTDTSQTFSSLARKIT
SLYYRRRFSTKDVEFQVENKVLYATKSAKKGHVCDDNYSREKLSSICRVLGFGDPIYTVE
SHQSESSLGPLQPTTLHPTNPSFDSPSSVSQMRRTSPSATLAPRLPAWNLSCLREPNCTS
TVISTCEPIRCSHCQQAACGDGSCIRFDQLCNGQIDCQSGEDEDYCRANSFRLTNGSDTS
GYLEVLFRSRWEPICADHLNGKISNSICDAMRLGK
Download sequence
Identical sequences C07G1.2 C07G1.2 6239.C07G1.2 C07G1.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]