SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C50F4.13 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C50F4.13
Domain Number 1 Region: 17-121
Classification Level Classification E-value
Superfamily Histone-fold 1.14e-45
Family Nucleosome core histones 0.0000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C50F4.13
Sequence length 127
Comment $ SECSG $ SQ40602 $ PDBT3233 $
Sequence
MSGRGKGGKAKTGGKAKSRSSRAGLQFPVGRLHRILRKGNYAQRVGAGAPVYLAAVLEYL
AAEVLELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPK
KTAGDKE
Download sequence
Identical sequences E3NT38 Q27485
C50F4.13 281687.CJA01111 281687.CJA02621 31234.CRE15215 6239.C50F4.13.2 CRE15215 C50F4.13 CJA01111 CJA02621 C50F4.13 C50F4.13.1 NP_505463.1.50509 XP_003088432.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]