SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CaR117 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CaR117
Domain Number - Region: 19-110
Classification Level Classification E-value
Superfamily ARM repeat 0.0372
Family Armadillo repeat 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CaR117
Sequence length 115
Comment $ NESG $ SQ108651 $ PDBT138665 $
Sequence
MGVATMVTDKYQKCIDACNRCSQACYECFKACLNEPDVNARRTCISILFECAQMCQMSSA
LMSMDAQFAIDHCKLCSVICDKCAQECSMFQDPHCQKCANECRTCSNECRMMSGM
Download sequence
Identical sequences Q97MW6
gi|337735284|ref|YP_004634731.1| gi|384456793|ref|YP_005669213.1| 272562.CA_C0075 gi|15893371|ref|NP_346720.1| CaR117 NP_346720.1.94244 WP_010963402.1.17575 WP_010963402.1.17905 WP_010963402.1.48544 WP_010963402.1.57811 WP_010963402.1.71350 WP_010963402.1.92914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]