SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CgR153 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CgR153
Domain Number 1 Region: 36-132
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.64e-21
Family Ankyrin repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CgR153
Sequence length 135
Comment $ NESG $ SQ226272 $ PDBT168203 $
Sequence
MSMTQSDLPDDVQELVTKIFGLARDGGAESAATLGAYVDNGVDVNLSNQDGNTLLMLAAY
AGHADVVQALIERGADVDRVNNRNQTPLAGAIFKKEEAVIEALLAGGADPYAGTPTAVDT
AKMFGREDLVARFES
Download sequence
Identical sequences A0A2H5IAW9 Q8NN64
NP_601546.2.3765 WP_011015056.1.21641 WP_011015056.1.3871 WP_011015056.1.4395 WP_011015056.1.80527 WP_011015056.1.91554 CgR153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]