SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CohIXDocII-CohII from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CohIXDocII-CohII
Domain Number 1 Region: 8-148
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 6.28e-38
Family Cellulose-binding domain family III 0.00000115
Further Details:      
 
Domain Number 2 Region: 157-250
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 7.06e-18
Family Pre-dockerin domain 0.0000031
Further Details:      
 
Domain Number 3 Region: 253-309
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000144
Family Type I dockerin domain 0.0000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CohIXDocII-CohII
Sequence length 320
Comment $ BSGI $ SQ128421 $ PDBT238171 $
Sequence
MTITPNKLTLKIGRAEGRPGDTVEIPVNLYGVPQKGIASGDFVVSYDPNVLEIIEIEPGE
LIVDPNPTKSFDTAVYPDRKMIVFLFAEDSGTGAYAITEDGVFATIVAKVKEGAPEGFSA
IEISEFGAFADNDLVEVETDLINGGVLVTNKPVIEGYKVSGYILPDFSFDATVAPLVKAG
FKVEIVGTELYAVTDANGYFEITGVPANASGYTLKISRATYLDRVIANVVVTGDTSVSTS
QAPIMMWVGDIVKDNSINLLDVAEVIRCFNATKGSANYVEELDINRNGAINMQDIMIVHK
HFGATSSDYDAQLEHHHHHH
Download sequence
Identical sequences CohIXDocII-CohII

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]