SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CsR32 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CsR32
Domain Number 1 Region: 4-75
Classification Level Classification E-value
Superfamily PGBD-like 0.000000455
Family Peptidoglycan binding domain, PGBD 0.057
Further Details:      
 
Domain Number 2 Region: 131-230
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.00000755
Family CHAP domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CsR32
Sequence length 265
Comment $ NESG $ SQ91727 $ PDBT131581 $
Sequence
MPNTLKRLIPDPEVIKLQQLLSSNGYFEEIKPSHGLFDGITFDNAVLFQLQHIYKDGDPL
KPDGVIGAKTWWALKNPSGEKQRNHLSASIPAGLTTKRHQLIELIIEEHSKPVFEVPDGS
NRSPDIDGYWGNTGVIGLAWCCAFVSWVLKEVTDSYPIASTHHLGVQRMWRTAKRLNMTT
EIPKPGDIFVQLFAGGKGHTGFVVAVTEDGETIYTCEGNCGNRLKIGKRSNNSELHFIDC
LQDNQTLDFERMAFDVNSTIDNTTR
Download sequence
Identical sequences Q480Z9
WP_011043464.1.15195 gi|71278853|ref|YP_269370.1| CsR32 167879.CPS_2656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]