SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DrT49 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DrT49
Domain Number 1 Region: 16-250
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.79e-34
Family APH phosphotransferases 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DrT49
Sequence length 286
Comment $ NESG $ SQ36433 $ PDBT125694 $
Sequence
MSILVPEQVREALDVHVVSFLGGRLNKHWLVDVCGHKLVLRRWAADREDAGYERDLRQAI
RASGWPVARDVTALTEIAGELWSLAEFLPGEPHPEKNSAAELSLRGRLMAEFHQVTASLN
PGRRKHWRLPDEILSDDHLEQVFEHCPDVRLRRLLFWHLQRGRQLAAGLPWSEQSLQLIH
GDFTPWNLLYREGQLSGLLDCEMSRPEYRISEFALSWRGRYDALIHAYHAVSPLSAPEWN
MLTPAWWALLLEGAYRNLVSGTEDQGWTAGMLLRRSPLMGIESCPC
Download sequence
Identical sequences Q9RWJ9
359269 DrT49 gi|15805696|ref|NP_294392.1| NP_294392.1.55610 WP_010887314.1.45201 WP_010887314.1.61927 WP_010887314.1.86829 243230.DR_0669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]