SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F45F2.12 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F45F2.12
Domain Number 1 Region: 6-123
Classification Level Classification E-value
Superfamily Histone-fold 6.93e-56
Family Nucleosome core histones 0.00000653
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F45F2.12
Sequence length 123
Comment $ SECSG $ SQ48069 $ PDBT9953 $
Sequence
MAPPKPSAKGAKKAAKTVTKPKDGKKRRHARKESYSVYIYRVLKQVHPDTGVSSKAMSIM
NSFVNDVFERIAAEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYT
SSK
Download sequence
Identical sequences Q27894
F07B7.4 F45F2.12 K06C4.12 K06C4.4 T10C6.11 F45F2.12 K06C4.12 K06C4.4 F45F2.12 NP_505197.1.50509 NP_505278.2.50509 NP_505294.1.50509 NP_505295.1.50509 NP_507031.2.50509 6239.F45F2.12 6239.K06C4.12 6239.K06C4.4 F07B7.4 F45F2.12 K06C4.12 K06C4.4 T10C6.11

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]