SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F45F2.2 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F45F2.2
Domain Number 1 Region: 18-112
Classification Level Classification E-value
Superfamily Histone-fold 9.83e-50
Family Nucleosome core histones 0.0000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F45F2.2
Sequence length 112
Comment $ SECSG $ SQ45234 $ PDBT10020 $
Sequence
MNFLKMFLRGFKYLTPNFLHKESYSLYIFRVLKQVHPDTGVSSKAMSIMNSFVNDVFERI
AAEASRLAHYNKRSTISSREIQTAVRLILPGELAKNAVSEGTNAVTKYTSSK
Download sequence
Identical sequences F45F2.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]