SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GO.34705 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.34705
Domain Number 1 Region: 15-218
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.45e-53
Family SPRY domain 0.00000000546
Further Details:      
 
Domain Number 2 Region: 221-262
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000101
Family SOCS box-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GO.34705
Sequence length 263
Comment $ CESG $ SQ5679 $ PDBT206505 $
Sequence
MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVK
EGGLYFERRPVAQSTDGARGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQTDHY
AALLGSNSESWGWDIGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGY
AIGGTYLGPAFRGLKGRTLYPAVSAVWGQCQVRIRYLGERRAEPHSLLHLSRLCVRHNLG
DTRLGQVSALPLPPAMKRYLLYQ
Download sequence
Identical sequences Q99619
NP_001139788.1.87134 NP_001139788.1.92137 NP_001306599.1.87134 NP_001306599.1.92137 NP_116030.1.87134 NP_116030.1.92137 GO.34705 gi|14249178|ref|NP_116030.1| gi|226423903|ref|NP_001139788.1| ENSP00000428338 ENSP00000430872 ENSP00000428338 ENSP00000430872 ENSP00000469611 ENSP00000470303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]