SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GO.35102 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.35102
Domain Number 1 Region: 41-102
Classification Level Classification E-value
Superfamily Histone-fold 0.00000483
Family Archaeal histone 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GO.35102
Sequence length 174
Comment $ CESG $ SQ5952 $ PDBT207613 $
Sequence
MADAAATAGAGGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVET
LTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVIT
APPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPVSDEALGLRVV
Download sequence
Identical sequences A0A0A0MRR3
ENSP00000362069 ENSP00000362069 GO.35102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]