SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GO.42335 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.42335
Domain Number 1 Region: 75-245
Classification Level Classification E-value
Superfamily TPR-like 4.02e-19
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.42335
Sequence length 297
Comment $ CESG $ SQ7078 $ PDBT208757 $
Sequence
MAKVSELYDVTWEEMRDKMRKWREENSRNSEQIVEVGEELINEYASKLGDDIWIIYEQVM
IAALDYGRDDLALFCLQELRRQFPGSHRVKRLTGMRFEAMERYDDAIQLYDRILQEDPTN
TAARKRKIAIRKAQGKNVEAIRELNEYLEQFVGDQEAWHELAELYINEHDYAKAAFCLEE
LMMTNPHNHLYCQQYAEVKYTQGGLENLELSRKYFAQALKLNNRNMRALFGLYMSASHIA
SNPKASAKTKKDNMKYASWAASQINRAYQFAGRSKKETKYSLKAVEDMLETLQITQS
Download sequence
Identical sequences A0A2I3HKT0 A0A2K5CF52 A0A2K5QE64 E2R0P8 F7H7M1 G1M2I0 G3RR20 H2QWK7 M3X1G2 M3Y3G4 Q15006
ENSPTRP00000035068 ENSNLEP00000005107 ENSCAFP00000001022 ENSP00000220853 9598.ENSPTRP00000035068 9606.ENSP00000220853 9615.ENSCAFP00000001022 GO.42335 HR5644 ENSP00000220853 ENSCJAP00000011885 ENSGGOP00000018244 ENSAMEP00000013541 ENSAMEP00000013541 gi|7661910|ref|NP_055488.1| ENSCAFP00000001022 ENSMPUP00000005865 ENSP00000220853 ENSCJAP00000011885 ENSPTRP00000035068 ENSMPUP00000005865 NP_055488.1.87134 NP_055488.1.92137 XP_001135909.1.37143 XP_002759345.1.60252 XP_003256155.1.23891 XP_004047481.1.27298 XP_004403904.1.74151 XP_004403905.1.74151 XP_007075899.1.5354 XP_007075900.1.5354 XP_008687480.1.72690 XP_008687482.1.72690 XP_008973475.1.60992 XP_011289733.1.62641 XP_011289734.1.62641 XP_012298725.2.9421 XP_012900667.1.14098 XP_015390205.1.5354 XP_017384495.1.71028 XP_017515229.1.32401 XP_017515230.1.32401 XP_019323398.1.44245 XP_019323399.1.44245 XP_019654690.1.58354 XP_019654691.1.58354 XP_850261.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]