SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GO.527 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.527
Domain Number 1 Region: 120-300
Classification Level Classification E-value
Superfamily E set domains 9.8e-62
Family Cytoplasmic domain of inward rectifier potassium channel 0.000014
Further Details:      
 
Domain Number 2 Region: 36-162
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.62e-21
Family Voltage-gated potassium channels 0.000047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GO.527
Sequence length 303
Comment $ NYCOMPS $ SQ157703 $ PDBT333443 $
Sequence
MKFQLKRLAKKRPDRVQIKIQDGQFEIIGMGVWHSYWRDPYHLLLTIPWTGFLLLICLSY
LAINLIFALAYWLGGDCIANAKPGNFLDLFFFSVQTLASIGYGAMYPKTLYANTVVTIEA
MIGLVGIAVMTGLAFARFSRPSARVIFSRVAVITPYNDVPTLMFRTANQRRNLILEAQMR
VYLMRDEITAEGGFIRRFHDLKLLRNQTPSFTLSWLALHPIDEFSPLYGMSAESLIQTNT
NIIISVSGIDETVAQVVHARYTYTASNILWNSRFVDIFHHTSDGHRYIDYKYFHDVLPLD
KIG
Download sequence
Identical sequences A0A1Z4KSH6 Q8YY97
gi|17228449|ref|NP_484997.1| 103690.all0954 WP_010995128.1.33676 GO.527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]