SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GO.706 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.706
Domain Number 1 Region: 4-111
Classification Level Classification E-value
Superfamily Histone-fold 2.67e-41
Family Nucleosome core histones 0.0000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.706
Sequence length 134
Comment $ CESG $ SQ1058 $ PDBT210027 $
Sequence
MSGKGAKGLIMGKPSGSDKDKDKKKPITRSSRAGLQFPVGRVHRLLKTRSTAHGRVGATA
AVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKGTIAGGGVI
PHIHKSLINKSAKE
Download sequence
Identical sequences A0A087H0X1 A0A178WNI4 A0A1J3EZF7 D7KJK7 Q9C944
3702.AT1G52740.1-P 59689.fgenesh2_kg.1__4354__AT1G52740.1 GO.706 jgi|Araly1|474400|fgenesh2_kg.1__4354__AT1G52740.1 AT1G52740.1 AT1G52740.1 NP_175683.1.80155 XP_002891713.1.15461 XP_010462129.1.75697 XP_010479795.1.75697 XP_010500891.1.75697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]