SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GO.81837 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.81837
Domain Number 1 Region: 112-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000544
Family Cripto EGF-like domain-like 0.00038
Further Details:      
 
Domain Number 2 Region: 78-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000454
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GO.81837
Sequence length 188
Comment $ CESG $ SQ111092 $ PDBT205632 $
Sequence
MDCRKMARFSYSVIWIMAISKVFELGLVAGLGHQEFARPSRGYLAFRDDSIWPQEEPAIR
PRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPH
DTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLVGI
CLSIQSYY
Download sequence
Identical sequences P13385
NP_003203.1.87134 NP_003203.1.92137 ENSP00000296145 ENSP00000296145 gi|4507425|ref|NP_003203.1| ENSP00000296145 9606.ENSP00000296145 GO.81837 HR6278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]