SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GO.91411 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GO.91411
Domain Number - Region: 30-114
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00011
Family WD40-repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.91411
Sequence length 147
Comment $ CESG $ SQ7531 $ PDBT209578 $
Sequence
MRERKKYGKHIPKSLSSKINKRKLIQKNICTNYKTIKIIDIYENLPYNQLNNGRTKIKEI
ILANDVLVVLLISGISRAYNMINGEFLCEINPNNFSVVHTIVYNSYNNTLIIAYASFPAH
LQCKVIDCNDLKHGITNSSKLGILFGT
Download sequence
Identical sequences GO.78794 GO.91411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]