SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H02I12.6 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H02I12.6
Domain Number 1 Region: 7-123
Classification Level Classification E-value
Superfamily Histone-fold 9.51e-56
Family Nucleosome core histones 0.0000099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H02I12.6
Sequence length 123
Comment $ SECSG $ SQ46416 $ PDBT4968 $
Sequence
MPPKPSAKGAKKAAKTVVAKPKDGKKRRHARKESYSVYIYRVLKQVHPDTGVSSKAMSIM
NSFVNDVFERIASEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYT
SSK
Download sequence
Identical sequences Q27876
B0035.8 F54E12.4 F55G1.3 H02I12.6 6239.B0035.8 6239.F54E12.4 6239.F55G1.3 6239.H02I12.6 B0035.8 F55G1.3 H02I12.6 NP_501202.1.50509 NP_502132.1.50509 NP_502140.1.50509 NP_502149.1.50509 B0035.8 F54E12.4 F55G1.3 H02I12.6 B0035.8 F54E12.4 F55G1.3 H02I12.6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]