SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HR1027 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR1027
Domain Number 1 Region: 25-93
Classification Level Classification E-value
Superfamily TPR-like 0.000000617
Family Tetratricopeptide repeat (TPR) 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HR1027
Sequence length 149
Comment $ NESG $ SQ31505 $ PDBT119357 $
Sequence
MAHLKDSEGMGRTKFLSIQDEFCHFLQMTGQKERATSILRESLEAKVEAFGDFSPEVAET
YRLLGGADLAQGNHSGARKKLKKCLQIQTLLYGPQDKRTLATQQAMGMLSTAPKVASKPR
QASKAKVAFCTSIPQDTLLGKARPGTTAD
Download sequence
Identical sequences B3KMY5
HR1027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]