SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HR1264 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR1264
Domain Number 1 Region: 17-59
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000032
Family Pleckstrin-homology domain (PH domain) 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HR1264
Sequence length 59
Comment $ NESG $ SQ31738 $ PDBT119594 $
Sequence
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNK
Download sequence
Identical sequences HR1264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]